DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Pla2r1

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001094307.1 Gene:Pla2r1 / 295631 RGDID:1309777 Length:1461 Species:Rattus norvegicus


Alignment Length:157 Identity:34/157 - (21%)
Similarity:71/157 - (45%) Gaps:26/157 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 NWFDAMTKCREMGGHLASPQNEEELHLISQKLD--TESYWLDLSDLTD-------HGQYISLVSG 221
            :|.:|.:.|:..||.|.|..:|.|...|.::|.  .:..|..|:.|.:       .|..:|.::.
  Rat   253 SWNEAHSSCQMQGGALLSITDENEEAFIRKELSRVAKEVWTGLNQLDEMAGWQWSDGTPLSYLNW 317

  Fly   222 SK----APFLKWNKGQPNRENAQCVRVKGGLYQTFQCDHRVLFICQANQNRKKEDEINKNQGKPR 282
            |:    .||::::.|        .::|....:::..|:..:.:||:.:.|...||.:.|:..|..
  Rat   318 SQEVTAGPFVEYHCG--------TLKVASATWRSMDCESTLPYICKRHLNHTAEDILQKDSWKYH 374

  Fly   283 IMEKER-----SKEEEKRKEEERRREE 304
            ....:.     :::..|.|:|:|..:|
  Rat   375 TTHCDPGWTPFNRKCYKLKKEKRTWQE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 23/109 (21%)
Pla2r1NP_001094307.1 RICIN 46..143 CDD:214672
RICIN 54..>133 CDD:238092
FN2 173..220 CDD:238019
CLECT 230..355 CDD:214480 23/109 (21%)
CLECT 378..502 CDD:214480 5/24 (21%)
CLECT 515..642 CDD:214480
CLECT 662..795 CDD:214480
CLECT 814..936 CDD:214480
CLECT 955..1094 CDD:214480
CLECT 1118..1229 CDD:214480
CLECT 1251..1375 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.