DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Sftpa1

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001257574.1 Gene:Sftpa1 / 24773 RGDID:3665 Length:258 Species:Rattus norvegicus


Alignment Length:152 Identity:36/152 - (23%)
Similarity:66/152 - (43%) Gaps:14/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LEKSLRKALNALQCS-LDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTK-CREMGGHL 181
            |::.|:..|..::.. |.|..|   :||......||.:.|  ..:.:...||.:.: |...||::
  Rat   113 LDEELQTELYEIKHQILQTMGV---LSLQGSMLSVGDKVF--STNGQSVNFDTIKEMCTRAGGNI 172

  Fly   182 ASPQNEEE---LHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENAQ-CV 242
            |.|:..||   :..|::|.:...|...:.|.|. |.: ..:.|:...:..|..|:|..:..: ||
  Rat   173 AVPRTPEENEAIASIAKKYNNYVYLGMIEDQTP-GDF-HYLDGASVNYTNWYPGEPRGQGKEKCV 235

  Fly   243 RV-KGGLYQTFQCDHRVLFICQ 263
            .: ..|.:....|....|.:|:
  Rat   236 EMYTDGTWNDRGCLQYRLAVCE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 27/121 (22%)
Sftpa1NP_001257574.1 Collagen 37..108 CDD:189968
CLECT_collectin_like 146..258 CDD:153061 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11575
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.