DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Mbl1

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:174 Identity:42/174 - (24%)
Similarity:73/174 - (41%) Gaps:30/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KALKVKMEGHFMDLHAKMEIKVKKLSLEKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFF 157
            :|::||:        |.||.::..|..:..|...|:|....                :|.|.:||
  Rat    89 RAIEVKL--------ANMEAEINTLKSKLELTNKLHAFSMG----------------KKSGKKFF 129

  Fly   158 YIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGS 222
             :..|.:..:......|.|:.|.:|.|:|.||...|.:...|.:: |.::|....||:: .|:|.
  Rat   130 -VTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAKTSAF-LGITDEVTEGQFM-YVTGG 191

  Fly   223 KAPFLKWNKGQPNRENA--QCVR-VKGGLYQTFQCDHRVLFICQ 263
            :..:..|.|.:||...:  .||. |..||:....|......:|:
  Rat   192 RLTYSNWKKDEPNDHGSGEDCVTIVDNGLWNDISCQASHTAVCE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 31/118 (26%)
Mbl1NP_036731.2 Collagen <36..86 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87
CLECT_collectin_like 126..236 CDD:153061 30/113 (27%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.