DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and clec-89

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001293152.1 Gene:clec-89 / 24104193 WormBaseID:WBGene00015631 Length:324 Species:Caenorhabditis elegans


Alignment Length:220 Identity:42/220 - (19%)
Similarity:76/220 - (34%) Gaps:74/220 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GHQEV-NDKQLKALKVKMEGHFMDLHAKMEIKVKKLSLEKSLRKALNALQCSLDTRNVSSKVSLH 146
            |.:|| :....|.:.:|.:||:|:.:                        || .|..|..:..||
 Worm   137 GLEEVGSSNSNKCINIKSDGHWMNAN------------------------CS-STAAVICEKKLH 176

  Fly   147 PEFEKVGSRFFYIERHVKQNW--------------------FDAMTKCREMG------GHLASPQ 185
            ..:.|          |..::|                    .:|..||.:.|      ..|.|.:
 Worm   177 RPYSK----------HCPKHWVYNKETQACYRTISKTNMTILEADNKCFDYGFEHRQDAMLTSIE 231

  Fly   186 NEEE----LHLISQK-LDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENAQCVRV- 244
            :|.|    ::|..:| .:.|..:|.....:.:|.....:.||:..::.|::|.|....|..|.| 
 Worm   232 SESENQFVMNLAKEKDANFEFIYLGGYGRSRNGNKWHWMDGSEFNYMNWDRGMPFGRRALAVLVM 296

  Fly   245 -KGGLYQTFQCD-----HRVLFICQ 263
             |.|.:.....|     :..:.:|:
 Worm   297 NKRGKWINHYADKILSQYNAVAVCK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 27/153 (18%)
clec-89NP_001293152.1 CLECT 31..172 CDD:214480 12/59 (20%)
CLECT 183..321 CDD:214480 25/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22803
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.