DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Sftpd

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:151 Identity:40/151 - (26%)
Similarity:70/151 - (46%) Gaps:11/151 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SLRKALNALQCSLDTRNVS----SKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLA 182
            :||:.:.||:..|....|:    .|.:|.|:...||.:.|......|. :.||...|::.||.||
Mouse   225 ALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKP-FEDAQEMCKQAGGQLA 288

  Fly   183 SPQNEEELHLISQKL--DTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENA--QCVR 243
            ||::..|...|.|.:  ..::.:|.::|:...|:: :..:|....:..|..|:||....  .||.
Mouse   289 SPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKF-TYPTGEPLVYSNWAPGEPNNNGGAENCVE 352

  Fly   244 V-KGGLYQTFQCDHRVLFICQ 263
            : ..|.:....|..:.|.||:
Mouse   353 IFTNGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 31/120 (26%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222
Collagen 45..102 CDD:189968
Collagen 129..>171 CDD:189968
Surfac_D-trimer 223..267 CDD:286141 12/41 (29%)
CLECT_collectin_like 261..374 CDD:153061 29/115 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.