DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Reg1

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_033068.1 Gene:Reg1 / 19692 MGIID:97895 Length:165 Species:Mus musculus


Alignment Length:135 Identity:36/135 - (26%)
Similarity:59/135 - (43%) Gaps:13/135 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 SSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREM-GGHLASPQNEEE----LHLISQKLDT 199
            |:::|. ||.....|.:.|.....:..|.||...|:.| .|:|.|..::.|    ..||.:...|
Mouse    30 SARISC-PEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTT 93

  Fly   200 E-SYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNREN-AQCVRVKGGL-YQTFQ---CDHRV 258
            : :.|..|.|...:.:: ...|||...:..|..|.||..| ..||.:.... |:.::   ||.:.
Mouse    94 DANVWTGLHDPKRNRRW-HWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQY 157

  Fly   259 LFICQ 263
            .|:|:
Mouse   158 SFVCK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 33/126 (26%)
Reg1NP_033068.1 CLECT 35..163 CDD:295302 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.