DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Pla2r1

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_032893.1 Gene:Pla2r1 / 18779 MGIID:102468 Length:1487 Species:Mus musculus


Alignment Length:148 Identity:35/148 - (23%)
Similarity:55/148 - (37%) Gaps:40/148 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 RFFYIERHVKQNWFDAMTKC----------------------REMGGHLASP-------QNEEEL 190
            |.|||.:...|...|..:.|                      ....|:..||       :.|:..
Mouse   498 RLFYICKKAGQVPADEQSGCPAGWERHGRFCYKIDTVLRSFEEASSGYYCSPALLTITSRFEQAF 562

  Fly   191 --HLISQKLDTESY-WLDLSDLTDHGQYISLVSGSKAP--FLKWNKGQPNRENAQCVRVKG---- 246
              .|||...:.:|| |:.|.|..:.|:|.....|.:.|  :..||..||:.... ||.|:|    
Mouse   563 ITSLISSVAEKDSYFWIALQDQNNTGEYTWKTVGQREPVQYTYWNTRQPSNRGG-CVVVRGGSSL 626

  Fly   247 GLYQTFQC-DHRVLFICQ 263
            |.::...| |.:.:.:|:
Mouse   627 GRWEVKDCSDFKAMSLCK 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 34/146 (23%)
Pla2r1NP_032893.1 RICIN 47..154 CDD:214672
RICIN 55..>123 CDD:238092
FN2 175..222 CDD:238019
CLECT 245..358 CDD:153057
CLECT 380..504 CDD:214480 4/5 (80%)
CLECT 517..644 CDD:214480 28/127 (22%)
CLECT 664..796 CDD:214480
CLECT 816..938 CDD:214480
CLECT 957..1096 CDD:214480
CLECT 1120..1231 CDD:214480
CLECT 1253..1377 CDD:214480
Endocytosis signal 1435..1441
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1463..1487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.