DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and F07F6.2

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_001343651.1 Gene:F07F6.2 / 184147 WormBaseID:WBGene00017216 Length:259 Species:Caenorhabditis elegans


Alignment Length:105 Identity:34/105 - (32%)
Similarity:59/105 - (56%) Gaps:8/105 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 KEEERKEEERRKEEERKEEERRKEEERRKEKRRRDEKRRREEE--KRKEEERKEE---ERREEAE 445
            |||..::..:.|||.|:.:....||:...::...|.|.:.|:|  |||:.|.:|:   .|.|:.:
 Worm   158 KEEVDRQTLKFKEEARRIKRLMIEEDWHVKEANEDVKNKIEQEGLKRKDMEFEEQLYHLRIEKVK 222

  Fly   446 RKEEERKAEERRKKEERRREEKRRREEKRRREEEERRKEE 485
            |:|:..|.:...||.:||:..:||   |:|||....::|:
 Worm   223 RREQVLKQKLEEKKAKRRQNAERR---KKRREIAMEQREQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480
F07F6.2NP_001343651.1 DUF3552 142..>259 CDD:330423 33/103 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.