DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and clec-178

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_500843.1 Gene:clec-178 / 177344 WormBaseID:WBGene00020585 Length:178 Species:Caenorhabditis elegans


Alignment Length:113 Identity:32/113 - (28%)
Similarity:46/113 - (40%) Gaps:25/113 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 WFDAMTKCREMGGHLASPQNEEE---LHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLK 228
            |..|...||.|||||.|.::|.|   :|.:.:|   .:.|:.|:.|.|.........||:|.:|.
 Worm    71 WIPAENVCRSMGGHLVSIKDESENLFVHKLRKK---NNIWIGLNKLNDTFHVYKWSDGSEADYLN 132

  Fly   229 WNKGQPNRENAQCVRVKGGLYQTFQCDHR-------------VLFICQ 263
            |...|||..:..|.      |..|..:.|             ..|:|:
 Worm   133 WASSQPNEPDVDCA------YMAFHQEQRGTWFDYGCREMLPQFFVCK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 31/111 (28%)
clec-178NP_500843.1 CLECT 52..174 CDD:214480 31/111 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.