DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and clec-161

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_499125.3 Gene:clec-161 / 176357 WormBaseID:WBGene00010228 Length:862 Species:Caenorhabditis elegans


Alignment Length:490 Identity:89/490 - (18%)
Similarity:165/490 - (33%) Gaps:113/490 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 QCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQ 195
            :|.:.|.|..:..||:..|:      .|   :..:::..|...|..:||.||...|:::..|.|.
 Worm    28 ECKIGTVNPLASTSLNACFK------LY---NTPKSFQAARRYCVSLGGQLADKINKDDSSLYSA 83

  Fly   196 KLDTE-----SYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENAQCVRVK----GGLYQT 251
            ..|.|     .:|:..|:|..:   |:..:|.:   :::|...........|.:.    |||:.|
 Worm    84 NADLEVANSTKFWVGASNLKCN---IAWENGGE---IEFNDMWAPESRYYGVAIDKMSIGGLWHT 142

  Fly   252 FQCDHRVLFIC--QANQNRKKEDEIN--KNQGKPRIMEKERSKEEEKRKEEERRREEERKREEER 312
            .....::.|:|  |...|......::  :...|.|:.:.|  |.|||..:|........|:  |:
 Worm   143 VPVGQKLPFVCTFQGKSNEAGPAPVHAMRAPAKKRVPKVE--KPEEKDIDESLNAALSDKK--EK 203

  Fly   313 KREEERKREEERKREEERKREEERRKEEERKK--------EEEREREEERKREHN---------- 359
            |.....|::|.:|.||:..........:||||        ::|..:::|...|.|          
 Worm   204 KEVASDKKKESKKDEEDINESMNAALSDERKKSASLASSDKKESSKKDESSDEANLSASQVANAE 268

  Fly   360 ----------RKKEEERKREEKRRKEEEKRKEEER----RKEEERKEEERRKEEERKEE------ 404
                      ....:|...|.....|.|.||:..:    .|.:|...:....::..:|:      
 Worm   269 MSASISASSANSSSDESSDEAYDSAEIEMRKKIGKTVIAMKSQEMASQSDDYDKYTEEDLLSAAA 333

  Fly   405 -----------------------ERRKEEE---------------RRKEKRRRDEKRRREEEKR- 430
                                   :.:.:||               .|..|||.......:.|.. 
 Worm   334 SLIGGYILNAHWADSRTTNTSSFDSQTDEETLNMMMAIAEQIAMTMRSSKRRESSSSNTDSESAS 398

  Fly   431 -KEEERKEEERREEAERKEEERKAEERRKKEERRREEKRRREEKRRREEEERRKEEERREEEEKR 494
             .|..:..|:....|....:..|..|...|:|.........|:|...........:.:.:..::.
 Worm   399 ISESSQASEQAVMAAAMSAKSSKKSESSSKDESEDSASLNLEQKASAAASAALASKSKSDSSDQS 463

  Fly   495 KEEERRKDEERRREEEK---RKEEERREKERRREE 526
            |:::..........|.|   :|.|:.:..:...||
 Worm   464 KDQKSANVALAVVSENKHPTKKPEDPKSTKTTTEE 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 26/126 (21%)
clec-161NP_499125.3 CLECT 43..153 CDD:214480 25/124 (20%)
CLECT 549..688 CDD:214480
CLECT 702..826 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.