DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Mrc2

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_006532469.1 Gene:Mrc2 / 17534 MGIID:107818 Length:1513 Species:Mus musculus


Alignment Length:298 Identity:66/298 - (22%)
Similarity:113/298 - (37%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CNVFAENDILQDPLIS-------SYDRLKKLGEMCLIDILPILENISEQQ-----KEGYTANFRI 70
            |..|.:.|.|.|....       |:.......|....|:|.|.| |.||.     ..||::...|
Mouse   269 CETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSITE-IHEQTYINGLLTGYSSTLWI 332

  Fly    71 -FNETQGILDRIEGHQEVNDKQLK------------------ALKVKMEGHFMDLHAKMEIKVKK 116
             .|:    ||...|.|..::..||                  .::.:..|.:.:...       .
Mouse   333 GLND----LDTSGGWQWSDNSPLKYLNWESDQPDNPGEENCGVIRTESSGGWQNHDC-------S 386

  Fly   117 LSLEKSLRKALNA-LQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGH 180
            ::|....:|..|| ::.....|..:.||...|.::......:.::.. |::|.::...|...||.
Mouse   387 IALPYVCKKKPNATVEPIQPDRWTNVKVECDPSWQPFQGHCYRLQAE-KRSWQESKRACLRGGGD 450

  Fly   181 LASPQNEEELHLISQ--KLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPN--RENAQ- 240
            |.|..:..||..|::  |.:.|..|:.|:||.....: ....||...|..|:..:||  |::.: 
Mouse   451 LLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNF-EWSDGSLVSFTHWHPFEPNNFRDSLED 514

  Fly   241 CVRVKG--GLYQTFQCDHRVLFIC----QANQNRKKED 272
            ||.:.|  |.:....|:..:..||    :.:|...:||
Mouse   515 CVTIWGPEGRWNDSPCNQSLPSICKKAGRLSQGAAEED 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 31/126 (25%)
Mrc2XP_006532469.1 CLECT 1165..1277 CDD:214480
CLECT 1294..1427 CDD:214480
RICIN 80..195 CDD:214672
FN2 214..262 CDD:128373
CLECT 281..395 CDD:153057 21/125 (17%)
CLECT 416..539 CDD:214480 30/124 (24%)
CLECT 555..678 CDD:214480
CLECT 703..843 CDD:214480
CLECT 863..985 CDD:214480
CLECT 1006..1142 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.