DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and Mbl2

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_034906.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:150 Identity:42/150 - (28%)
Similarity:70/150 - (46%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 QCSLDTRNVSSKV-SLHPEF------------EKVGSRFFYIERHVKQNWFDAM-TKCREMGGHL 181
            :...||..:.|:: :|..|.            ||||.::|.  ..||:...|.: ..|.|..|.:
Mouse    96 RAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFV--SSVKKMSLDRVKALCSEFQGSV 158

  Fly   182 ASPQNEEELHLISQKLDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNR--ENAQCVRV 244
            |:|:|.||...| ||:..:..:|.::|:...|.:..| :|::..:..||.|:||.  :...||.:
Mouse   159 ATPRNAEENSAI-QKVAKDIAYLGITDVRVEGSFEDL-TGNRVRYTNWNDGEPNNTGDGEDCVVI 221

  Fly   245 KG-GLYQTFQCDHRVLFICQ 263
            .| |.:....|....|.||:
Mouse   222 LGNGKWNDVPCSDSFLAICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 37/131 (28%)
Mbl2NP_034906.1 Collagen 36..93 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101 0/4 (0%)
CLECT 132..242 CDD:470576 33/113 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.