DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and vcana

DIOPT Version :10

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_021331663.1 Gene:vcana / 116993 ZFINID:ZDB-GENE-011023-1 Length:8936 Species:Danio rerio


Alignment Length:266 Identity:54/266 - (20%)
Similarity:94/266 - (35%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 CSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQK 196
            |..||...|  ...| :|:  |..:.|...  ::||..|..:||..|.||||..:.:|...|: :
Zfish  8691 CEQDTETCS--YGWH-KFQ--GHCYKYFPH--RRNWDTAERECRLQGAHLASVLSHDEQQYIN-R 8747

  Fly   197 LDTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPN---RENAQCVRV---KGGLYQTFQCD 255
            |..:..|:.|:|......: ....|....:..|...||:   .....||.:   :.|.:....|:
Zfish  8748 LGHDYQWIGLNDKMFENDF-RWTDGRVVQYENWRPNQPDSFFSSGEDCVVMIWHEDGQWNDVPCN 8811

  Fly   256 HRVLFICQANQNRKKEDEINKNQGKPRIMEKERSKEEEKRKEE--------------ERRREEER 306
            :.:.|.|       |:..::.:|  |.|:...|:..:.:.:.|              :|.....|
Zfish  8812 YHLTFTC-------KKGTVSCSQ--PPIVHNARTFGQPRPRYEINSLIRYQCMDGFIQRHVPTIR 8867

  Fly   307 KREE--------------ERKREEERKREEERKREEERKREEERRKEEERKKEEEREREEERKRE 357
            .|.:              ..:|...|:.:........|||..|...:..|::..........|  
Zfish  8868 CRGDGLWDSPRISCMSPSNYQRSYTRRLQRYSVYRNNRKRSAEHSVDVHRRRHHHHHHHHGGK-- 8930

  Fly   358 HNRKKE 363
            |.|.|:
Zfish  8931 HIRTKQ 8936

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 28/121 (23%)
vcanaXP_021331663.1 Ig 31..149 CDD:472250
Ig strand B 40..44 CDD:409482
Ig strand C 66..70 CDD:409482
Ig strand E 110..114 CDD:409482
Ig strand F 124..129 CDD:409482
Ig strand G 142..145 CDD:409482
Link_domain_CSPGs_modules_1_3 147..241 CDD:239594
Link_domain_CSPGs_modules_2_4 249..343 CDD:239597
Herpes_BLLF1 <5897..>6290 CDD:282904
MSCRAMM_ClfA <8105..8452 CDD:468110
EGF 8622..8652 CDD:394967