DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and TRDN

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_006064.2 Gene:TRDN / 10345 HGNCID:12261 Length:729 Species:Homo sapiens


Alignment Length:606 Identity:137/606 - (22%)
Similarity:284/606 - (46%) Gaps:93/606 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 SKEEEKRKEEERRREEERKREEERKREEERKREEERKREEERKREEERRKEEERKKEEEREREE- 352
            |::||....:|...:.|......||:|..:.:.|::::.|.:.:.:...||:|:.||:.||:|: 
Human   116 SEDEEDDDGDEDTDKGEIDEPPLRKKEIHKDKTEKQEKPERKIQTKVTHKEKEKGKEKVREKEKP 180

  Fly   353 ERKREHNRKKEEERKREEKRRKEEEKRKEEERRKEEERKEEERRKEEERKEEERRKEEERRKEKR 417
            |:|..|..|.|::.|.|.|...:|:|:.:...:.||:.|:|.:..::|:.::...|.:|.:|...
Human   181 EKKATHKEKIEKKEKPETKTLAKEQKKAKTAEKSEEKTKKEVKGGKQEKVKQTAAKVKEVQKTPS 245

  Fly   418 RRDEKRRREEEKRKEEERKEEER---------------------------REEAERKEEERKAEE 455
            :..||..:|:....:.|:|::..                           .|:|.|......|.|
Human   246 KPKEKEDKEKAAVSKHEQKDQYAFCRYMIDIFVHGDLKPGQSPAIPPPLPTEQASRPTPASPALE 310

  Fly   456 RRKKEERRREEKRRREEKRRREEEERRKEEERREEEEKRKEEERRKDEERR-----------REE 509
             .|:.|:::.||:...|.:::|:|:.:|:.|:....:..|:|..:..|.::           :::
Human   311 -EKEGEKKKAEKKVTSETKKKEKEDIKKKSEKETAIDVEKKEPGKASETKQGTVKIAAQAAAKKD 374

  Fly   510 EKRKEEERREKERRREEGKRKEEERREKERRREEEKRKEEERREKERRDEERRREEERRREE--- 571
            ||:::.::.:|....|:.|.|::|::||    ..|..|..::......|::.:.:.||.:||   
Human   375 EKKEDSKKTKKPAEVEQPKGKKQEKKEK----HVEPAKSPKKEHSVPSDKQVKAKTERAKEEIGA 435

  Fly   572 -------ERRREEERRR--EEERRREEERRREEERKREEERRREEERRREEERRREEERRREEEK 627
                   ..::||:..:  |:|.|:|:..:.....|.:|..:.:||:.....:.:|.|.:::|:.
Human   436 VSIKKAVPGKKEEKTTKTVEQEIRKEKSGKTSSILKDKEPIKGKEEKVPASLKEKEPETKKDEKM 500

  Fly   628 RK--EEERRKEEERKREEEKRKEEERKREEERRREEEKRKEEERRKEEER-----KREEEKRKE- 684
            .|  :|.:.|..:.:.::|::.|.:.|:|.:....|:.:..::...:.|:     |.||:..|: 
Human   501 SKAGKEVKPKPPQLQGKKEEKPEPQIKKEAKPAISEKVQIHKQDIVKPEKTVSHGKPEEKVLKQV 565

  Fly   685 -----EKRKREEEKRKKEERKREEEKRKEDERKREEEKRKEEEKRKEEERKEEERKKKETEEKE- 743
                 ||..:.:..:|.|.|:||....|.|:.|...:...|.   .|..:|:.|..:||::||. 
Human   566 KAVTIEKTAKPKPTKKAEHREREPPSIKTDKPKPTPKGTSEV---TESGKKKTEISEKESKEKAD 627

  Fly   744 -KNMQEKCWVTKKGTNKCKTCSTNEKGKKKCEVCWIRKDGE-----KKCKKS------KKKKKPS 796
             |:::|:...|:|.:.:....:..||..:      :.||.|     ||.|:.      .|:|.|.
Human   628 MKHLREEKVSTRKESLQLHNVTKAEKPAR------VSKDVEDVPASKKAKEGTEDVSPTKQKSPI 686

  Fly   797 YDDNTSY--NYKSYGTELKWS 815
            ......|  .|..||.:..::
Human   687 SFFQCVYLDGYNGYGFQFPFT 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480
TRDNNP_006064.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..265 39/147 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..682 89/414 (21%)
PTZ00121 <428..>672 CDD:173412 58/252 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..729 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.