Sequence 1: | NP_608540.1 | Gene: | CG2839 / 33244 | FlyBaseID: | FBgn0031273 | Length: | 826 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005743.5 | Gene: | CLEC3A / 10143 | HGNCID: | 2052 | Length: | 197 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 53/200 - (26%) |
---|---|---|---|
Similarity: | 88/200 - (44%) | Gaps: | 36/200 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 ILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAKMEIKVKKLSLEKSLRKALNALQ--CSLDTRNV 139
Fly 140 SSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLI----SQKL-DT 199
Fly 200 ESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPN---RENAQCV---RVKGGLYQTFQCDHRV 258
Fly 259 LFICQ 263 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2839 | NP_608540.1 | CLECT | 147..263 | CDD:214480 | 32/126 (25%) |
CLEC3A | NP_005743.5 | CLECT_tetranectin_like | 68..193 | CDD:153066 | 38/142 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I11773 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |