DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and colec11

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_004914539.1 Gene:colec11 / 100493760 XenbaseID:XB-GENE-952506 Length:277 Species:Xenopus tropicalis


Alignment Length:162 Identity:39/162 - (24%)
Similarity:70/162 - (43%) Gaps:21/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 KMEIKVKKLSLE-KSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMT 172
            :|:|:|.:|:.| |.::.||.:.......|...:|:.|..:.||              .:.||..
 Frog   124 EMDIQVAQLATEVKFVKNALPSPAVVAGVRETDTKIYLLVKEEK--------------KYIDAQD 174

  Fly   173 KCREMGGHLASPQNEEELHLISQKLD---TESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQP 234
            .|:..||.|:.|::|....||:..::   ....::.::||...|.::.........|.||.:|:|
 Frog   175 YCQGRGGTLSMPKDETTNSLIASYINQAGLSRVFIGINDLEREGHFVYSDRSPMQTFNKWRQGEP 239

  Fly   235 NR--ENAQCVR-VKGGLYQTFQCDHRVLFICQ 263
            |.  :...|.. |..|.:....|...:.|||:
 Frog   240 NNAYDEEDCAEMVSSGGWNDVSCLITMYFICE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 27/121 (22%)
colec11XP_004914539.1 Collagen 50..99 CDD:189968
CLECT_collectin_like 158..272 CDD:153061 30/128 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9757
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm72280
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.