DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and pla2r1

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_031749202.1 Gene:pla2r1 / 100488773 XenbaseID:XB-GENE-1000168 Length:1473 Species:Xenopus tropicalis


Alignment Length:267 Identity:60/267 - (22%)
Similarity:96/267 - (35%) Gaps:77/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GYTANFRIFNETQGILDRIEGHQEVNDKQLKALKVKMEGHFMDLHAKME---IKVKKLSLE---- 120
            |:..:.....|...|..||....:.|.|..  :.:..|.||..||...:   :..|....|    
 Frog   857 GHLLSIHSAAEQAFIESRIRKFVKTNKKWW--IGLSEEEHFYGLHRWTDGSPVVYKNWQTEPNGN 919

  Fly   121 KSLRKALNAL-----------QCSLDTRNV--SSKVSL-------HPEFEKVG----------SR 155
            |||...|.|.           :||.....:  :|::|.       ||..|..|          ::
 Frog   920 KSLEGPLCAYISAESGLWGFSECSASYSAICKTSQISKLEVAQQPHPRHEARGICPSDWLRDVNK 984

  Fly   156 FFYI-------ERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKL--DTESYWLDLSDLTD 211
            .:|:       |:|   :||.|.:.|:..||:|||.:||.|...|..:|  ...|.|:.. .:.|
 Frog   985 CYYVHSVEGSEEQH---DWFSAASYCQAHGGNLASIENEIEQAFIVMQLYGHKNSLWIQF-QIDD 1045

  Fly   212 HGQYISLVSGSKAPFLKWN------------KGQPNRENAQCVRVKG-------GLYQTFQCDHR 257
               ||:...||.:.:..|:            .|.|...  :|..:..       |.:....|:|:
 Frog  1046 ---YINWQKGSSSAYSNWSPILEKQHKQNFTNGNPAEH--ECALLASNHNFHWPGTWYLENCNHK 1105

  Fly   258 VL-FICQ 263
            .. |:|:
 Frog  1106 AHGFVCE 1112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 35/154 (23%)
pla2r1XP_031749202.1 RICIN 58..>141 CDD:214672
FN2 185..233 CDD:128373
CLECT 253..366 CDD:153057
CLECT 386..511 CDD:214480
CLECT 526..655 CDD:214480
CLECT 684..809 CDD:214480
CLECT 828..951 CDD:214480 21/95 (22%)
CLECT 974..1112 CDD:214480 32/146 (22%)
CLECT 1132..1248 CDD:214480
CLECT 1263..1389 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.