DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and mbl2

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:NP_571645.2 Gene:mbl2 / 100008009 ZFINID:ZDB-GENE-000427-2 Length:251 Species:Danio rerio


Alignment Length:150 Identity:39/150 - (26%)
Similarity:65/150 - (43%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 LEKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLAS 183
            :..||:..|..|.   |...:..||.....|:|||.: :|:...|::.:...|..|...||.|..
Zfish   103 MSDSLKSELQKLS---DKIALIEKVVNFKTFKKVGQK-YYVTDDVEETFDKGMQYCSSNGGALVL 163

  Fly   184 PQNEEELHLISQKLDT--ESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQP-NRENAQ-CVRV 244
            |:..||..|:...:.:  :..::.::|....|:::. ....|..|..|...|| |.:.|| |..:
Zfish   164 PRTLEENALLKVFVSSAFKRLFIRITDREKEGEFVD-TDRKKLTFTNWGPNQPDNYKGAQDCGAI 227

  Fly   245 -KGGLYQTFQCDHRVLFICQ 263
             ..||:....||.....||:
Zfish   228 ADSGLWDDVSCDSLYPIICE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 31/120 (26%)
mbl2NP_571645.2 CLECT_collectin_like 135..248 CDD:153061 28/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.