DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2839 and si:ch211-125e6.5

DIOPT Version :9

Sequence 1:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster
Sequence 2:XP_001337601.1 Gene:si:ch211-125e6.5 / 100002476 ZFINID:ZDB-GENE-070912-39 Length:151 Species:Danio rerio


Alignment Length:125 Identity:28/125 - (22%)
Similarity:58/125 - (46%) Gaps:12/125 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 FEKVGSRFFYIERHVKQN--WFDAMTKCREMGGHLASPQNEEELHLISQKLDTES--YWLDLSDL 209
            :.|.|.:.:   |.:.|:  |..|...|:.:|.:|||..::.|...:...:.:.|  .|:...|.
Zfish    30 WSKFGVKCY---RFISQSVTWATAEKNCQSLGANLASVHSKAEHDFLLSLIPSSSTRCWIGGHDG 91

  Fly   210 TDHGQYISLVSGSKAPFLKWNKGQPNRENAQ-CVRVKGGLYQTFQ---CDHRVLFICQAN 265
            .:.||:: ...||...:..|...:||.:|.: |:.::..:.:.:.   |...:.::|.||
Zfish    92 ENEGQWL-WTDGSAIDYNNWCATEPNNQNVENCMEMQWTVNRCWNDQACSTSMGYMCAAN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2839NP_608540.1 CLECT 147..263 CDD:214480 25/121 (21%)
si:ch211-125e6.5XP_001337601.1 CLECT 26..147 CDD:214480 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.