DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CLEC6A

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001007034.1 Gene:CLEC6A / 93978 HGNCID:14556 Length:209 Species:Homo sapiens


Alignment Length:151 Identity:40/151 - (26%)
Similarity:61/151 - (40%) Gaps:23/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYL 175
            :||.|..:.|||.:.|.....::..||..::|... .:.|..:...|..||.||.....|.|...
Human    62 SSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSE-EKVWSKSEQNCVEMGAHLVVFNTEAEQNF 125

  Fly   176 IRKQL-EARWFWLDISN--------LVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLY-- 229
            |.:|| |:..::|.:|:        .:||..|     .|.|.:  |..|||..|: ..||.:.  
Human   126 IVQQLNESFSYFLGLSDPQGNNNWQWIDKTPY-----EKNVRF--WHLGEPNHSA-EQCASIVFW 182

  Fly   230 ---AGDYYTYQCSDRNFFICQ 247
               ...:....|..|...||:
Human   183 KPTGWGWNDVICETRRNSICE 203

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 31/123 (25%)
CLEC6ANP_001007034.1 CLECT_DC-SIGN_like 79..204 CDD:153060 33/134 (25%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 168..170 1/1 (100%)