DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Sfp24F

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster


Alignment Length:131 Identity:37/131 - (28%)
Similarity:67/131 - (51%) Gaps:14/131 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 FQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEA----RWFWLDISNL 192
            |.::|:.|:.|||.:::|||.|.:.||:....|.:.:..|||.|:.:.|.|    ..:|...::|
  Fly    38 FVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTDL 102

  Fly   193 VDKDQYISLATGKEVSYLKWRHGEP-KKSSTANCAYLYAGDYYTYQ--------CSDRNFFICQA 248
            ..|.:::..:.|:.:|...|..||| .|::..:|..| ..|:...:        |:..:.|||:.
  Fly   103 GTKGKHVWFSNGQPLSTDLWYGGEPNNKNNEEHCDEL-GSDFRPTKSPGMNDRNCNFESSFICEE 166

  Fly   249 V 249
            |
  Fly   167 V 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 33/122 (27%)
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.