DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and si:dkeyp-94g1.1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_009297114.1 Gene:si:dkeyp-94g1.1 / 797092 ZFINID:ZDB-GENE-030131-7910 Length:546 Species:Danio rerio


Alignment Length:111 Identity:33/111 - (29%)
Similarity:53/111 - (47%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 YFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEARW---FWLDISNLVDKDQYIS 200
            |::|  ::|.:|.:|...||.....|||.:..|::..:...:.|::   .|:.:.....|....|
Zfish    32 YYFI--NIRMSWPEAQSYCRAKYTDLATAESTDDVNRLLNSVGAQYNGSVWIGLKRGTQKRWGWS 94

  Fly   201 LATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQCSDRNFFIC 246
            ........|..|.:|||  |||..|.:|..|::.||.|||..:|.|
Zfish    95 YGDNTIAQYAAWSNGEP--SSTNECGFLAYGNWRTYNCSDLIYFAC 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 33/111 (30%)
si:dkeyp-94g1.1XP_009297114.1 CLECT 30..140 CDD:321932 33/111 (30%)
CLECT 151..250 CDD:321932
CLECT 262..367 CDD:321932
CLECT 372..474 CDD:321932
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11184
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto41761
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17351
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.