DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and COLEC11

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001242914.1 Gene:COLEC11 / 78989 HGNCID:17213 Length:285 Species:Homo sapiens


Alignment Length:158 Identity:40/158 - (25%)
Similarity:67/158 - (42%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMG 161
            |:|......:...::.|...||..|....|....| .|:   |..::...|  :.||...|:..|
Human   130 SQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETE-SKI---YLLVKEEKR--YADAQLSCQGRG 188

  Fly   162 GHLATPQDED-----ELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKS- 220
            |.|:.|:||.     ..||.:..| ||.| :.|::|..:..::........::.|||.|||..: 
Human   189 GTLSMPKDEAANGLMAAYLAQAGL-ARVF-IGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAY 251

  Fly   221 STANCAYLYA-GDYYTYQCSDRNFFICQ 247
            ...:|..:.| |.:....|....:|:|:
Human   252 DEEDCVEMVASGGWNDVACHTTMYFMCE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 30/116 (26%)
COLEC11NP_001242914.1 Collagen 58..111 CDD:189968
CLECT_collectin_like 165..280 CDD:153061 32/122 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10327
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.