DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4g

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:242 Identity:52/242 - (21%)
Similarity:98/242 - (40%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLDPQGAQENNC--PKVSLSERLEKRGEFSLVEFDPLLKFIVKNPHKELLGEIEGLVGHTENKLQ 76
            |.|..||..|.|  .|..|        :.:|.||..:...:::  .:.:|.|::           
Mouse    84 LKDDIGACRNCCSVTKAQL--------QTTLAEFKDIQAKLME--QESILKELQ----------- 127

  Fly    77 PMKSVIPNQSKALLNYLDLHSKL-EYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYF 140
              :.|..:.:||..:..::.|:| :.|:|..::..:..||            |.......||.|:
Mouse   128 --ERVTQDLAKASRDRENIRSELFQALEAVKRQNSSCEQC------------PPSWLPFQGSCYY 178

  Fly   141 YIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEARWFWLDISNL--VDKDQYISLAT 203
            :.|  .:..|..|...|...|.||...:..:|...:.:....|.:||.:..:  ::|.|......
Mouse   179 FSE--TQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQGYRWVD 241

  Fly   204 GKEVSYLKWRHGEPKKS-STANC-AYLYAGDYYTYQC-SDRNFFICQ 247
            |..:::..|..|||..| ...:| ..|::|.:....| ::|:.:||:
Mouse   242 GASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/114 (24%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 20/101 (20%)
CLECT 165..289 CDD:295302 31/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.