DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Colec11

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:196 Identity:39/196 - (19%)
Similarity:76/196 - (38%) Gaps:49/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 KELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKV 122
            ::.:||::..|.....:|:.:|:.:|:.: |:....:..||:                       
Mouse   120 RKAIGEMDNQVTQLTTELKFIKNALPSPA-AVAGVRETESKI----------------------- 160

  Fly   123 MSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLE----AR 183
                            |..::...|  :.||...|:..||.|:.|:||....|:...|.    ||
Mouse   161 ----------------YLLVKEEKR--YADAQLSCQARGGTLSMPKDEAANGLMASYLAQAGLAR 207

  Fly   184 WFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKS-STANCAYLYA-GDYYTYQCSDRNFFIC 246
            .| :.|::|..:..::........::.|||.|||..: ...:|..:.| |.:....|....:|:|
Mouse   208 VF-IGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHITMYFMC 271

  Fly   247 Q 247
            :
Mouse   272 E 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 29/115 (25%)
Colec11NP_001300907.1 Collagen 41..96 CDD:189968
CLECT_collectin_like 158..273 CDD:153061 32/157 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10387
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.