Sequence 1: | NP_608539.2 | Gene: | lectin-21Cb / 33242 | FlyBaseID: | FBgn0040106 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001300907.1 | Gene: | Colec11 / 71693 | MGIID: | 1918943 | Length: | 278 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 39/196 - (19%) |
---|---|---|---|
Similarity: | 76/196 - (38%) | Gaps: | 49/196 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 58 KELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKV 122
Fly 123 MSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLE----AR 183
Fly 184 WFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKS-STANCAYLYA-GDYYTYQCSDRNFFIC 246
Fly 247 Q 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-21Cb | NP_608539.2 | CLECT | 137..247 | CDD:153057 | 29/115 (25%) |
Colec11 | NP_001300907.1 | Collagen | 41..96 | CDD:189968 | |
CLECT_collectin_like | 158..273 | CDD:153061 | 32/157 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 61 | 1.000 | Domainoid score | I10387 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |