DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Cd209g

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006508948.1 Gene:Cd209g / 70192 MGIID:1917442 Length:295 Species:Mus musculus


Alignment Length:185 Identity:40/185 - (21%)
Similarity:66/185 - (35%) Gaps:45/185 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIE 143
            |..:|.:        ..||.||.:....|      |.:..|..:....:|.|...:|.....|:.
Mouse   131 KVAVPRE--------QTHSGLEQIQQIQQ------QLTQFNASLAGLCRPCPWDWELFQGSCYLF 181

  Fly   144 RHVRQNWFDAADKCRRMGGHLATPQDEDE-----LYLIRK-QL----------EARWFWLDISNL 192
            .....:|..:|..|..:|.||.......|     .:.||| ||          |..|.|:|.:.|
Mouse   182 SRTLGSWETSASSCEDLGAHLVIVNSVSEQQFLKYWHIRKNQLTWIGLSDHRSEGSWQWVDDTPL 246

  Fly   193 VDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQCSDRNFFICQ 247
                         ::|:  |:.|||......:|..:....:...:|:..||::|:
Mouse   247 -------------KLSF--WKEGEPNNEGDEDCVVMAEDKWNDSRCTANNFWVCE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/125 (22%)
Cd209gXP_006508948.1 CLECT_DC-SIGN_like 167..286 CDD:153060 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I5465
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.