DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Klrb1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001078874.1 Gene:Klrb1 / 689817 RGDID:1587563 Length:214 Species:Rattus norvegicus


Alignment Length:168 Identity:36/168 - (21%)
Similarity:64/168 - (38%) Gaps:26/168 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDA 153
            |:.:|.....:|....|:|:  |..:.::::|.:......|..:.|.    .:|.:..|. |.:.
  Rat    58 LVGFLVQKPPIEKCSVAVQE--NKTEPTVRSTILECPRDWHLHWNKC----LFISQTSRP-WAEG 115

  Fly   154 ADKCRRMGGHLATPQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGE-- 216
            ...|...|..|....|..||.|::          |.|....:..:|.|...:|....||.:|.  
  Rat   116 LADCSLRGATLLLIGDGKELKLLQ----------DFSKGKGQQFFIGLKYVQEDKVWKWMNGSIL 170

  Fly   217 -------PKKSSTANCAYLYAGDYYTYQCSDRNFFICQ 247
                   ..|:...:||.:...:.::..||..|.:|||
  Rat   171 NTNLLRITGKNEENSCALISHTEVFSDSCSSDNHWICQ 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 25/118 (21%)
Klrb1NP_001078874.1 Neurensin 20..>69 CDD:291588 2/10 (20%)
CLECT_NK_receptors_like 91..209 CDD:153063 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.