DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Cd209f

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_001068161.4 Gene:Cd209f / 688750 RGDID:1585258 Length:277 Species:Rattus norvegicus


Alignment Length:292 Identity:53/292 - (18%)
Similarity:94/292 - (32%) Gaps:100/292 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QGAQENNCP-------KVSLSERLEKRGEFSLVEFDP-------------------LLKFIVKNP 56
            :|.:|...|       |..|.:......|.:|.:.||                   ||..::.  
  Rat     9 RGKEERGSPEKQKMAGKPELHQPNNHEEEVTLEDHDPEGLICSSKSLQGHLTRAPWLLPLLIS-- 71

  Fly    57 HKELLG----------EIEGLVGHTENKLQPMKS-------VIPNQSKALLNYLDLHSKLEYLDA 104
                ||          :|..:..:.:.:.|..|.       .:|.:        ..::.||.:..
  Rat    72 ----LGLFLLMLATLVQISRICANPQGQTQDQKGSSSFGKVAVPQE--------QTYTGLEQIQQ 124

  Fly   105 ALQKAINSLQCSLKNTKVMSTGKPHP---EFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLAT 166
            ..|      |.:..|..:....:|.|   ||.: ||.|.:  .....:|..:|..|:.:|.||..
  Rat   125 IQQ------QLTQFNASLAGLCRPCPWDWEFFQ-GSCYLF--SRTLASWGASASSCKDLGAHLVI 180

  Fly   167 PQDEDELYLIR----------------KQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHG 215
            .....|...::                .|.|..|.|:|.:.|             ::|:  |:.|
  Rat   181 VNSVAEQQFLKYWHIRQSQLTWIGLSDHQREGSWQWVDDTPL-------------KLSF--WKEG 230

  Fly   216 EPKKSSTANCAYLYAGDYYTYQCSDRNFFICQ 247
            ||..:...:|..:....:....||..||::|:
  Rat   231 EPNNAGDEDCVVIAEDKWNDSTCSANNFWVCE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 25/125 (20%)
Cd209fXP_001068161.4 CLECT_DC-SIGN_like 143..262 CDD:153060 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.