DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and illr1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001035139.1 Gene:illr1 / 677756 ZFINID:ZDB-GENE-050311-2 Length:253 Species:Danio rerio


Alignment Length:190 Identity:43/190 - (22%)
Similarity:71/190 - (37%) Gaps:53/190 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 NYLDLHSKLEYLDAALQKAINSLQ-------CSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQ 148
            |..|...:|:.|....|:.:..|.       |:|...:...:|         |..|::  ..|:.
Zfish    81 NVTDYMEQLDVLRIQHQETLRKLNRLNQSSGCALCAVRWTHSG---------GKCYYF--STVKM 134

  Fly   149 NWFDAADKCRRMGGHL---ATPQDEDELYLIRKQ----------LEARWFWLDISNLVDKDQYIS 200
            ||..:.|.|...||||   .:..::|.|....|:          .|..|.|:|...|....::  
Zfish   135 NWTQSRDHCVTKGGHLVIITSKAEQDFLTSNVKETHWIGLNDLDTEGHWIWVDNQPLSQTVEF-- 197

  Fly   201 LATGKEVSYLKWRHG--EP-----KKSSTANCAYL-YAG---DYYT-YQCSDRNFFICQA 248
                    ::|..:|  ||     :.....:||.| :.|   |::| ..|..:..|||:|
Zfish   198 --------WIKRENGVREPDNWTKQHVDGEDCASLGHPGGETDFWTDAYCFQKKRFICEA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 31/134 (23%)
illr1NP_001035139.1 CLECT_DC-SIGN_like 115..248 CDD:153060 33/153 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.