DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and SFTPA1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001087239.2 Gene:SFTPA1 / 653509 HGNCID:10798 Length:263 Species:Homo sapiens


Alignment Length:216 Identity:48/216 - (22%)
Similarity:74/216 - (34%) Gaps:62/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PHKELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNT 120
            |..:.|....|:.|....|.:|.:...|.        |..|     ||..||..::..:..:..|
Human    85 PGNDGLPGAPGIPGECGEKGEPGERGPPG--------LPAH-----LDEELQATLHDFRHQILQT 136

  Fly   121 K--------VMSTGKPHPEFQKLGSRYFYIERHVRQNWFDA-ADKCRRMGGHLATPQDEDELYLI 176
            :        :|:.|:  ..|...|          :...||| .:.|.|.||.:|.|::.:|    
Human   137 RGALSLQGSIMTVGE--KVFSSNG----------QSITFDAIQEACARAGGRIAVPRNPEE---- 185

  Fly   177 RKQLEARWFWLDISNLVDKDQ---YISL-----------ATGKEVSYLKWRHGEPKKSSTANCAY 227
               .||      |::.|.|..   |:.|           :.|..|:|..|..|||.......|..
Human   186 ---NEA------IASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVE 241

  Fly   228 LYA-GDYYTYQCSDRNFFICQ 247
            :|. |.:....|......||:
Human   242 MYTDGQWNDRNCLYSRLTICE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 29/125 (23%)
SFTPA1NP_001087239.2 Collagen 43..115 CDD:189968 7/37 (19%)
CLECT_collectin_like 151..263 CDD:153061 32/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.