DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and SFTPD

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_003010.4 Gene:SFTPD / 6441 HGNCID:10803 Length:375 Species:Homo sapiens


Alignment Length:177 Identity:42/177 - (23%)
Similarity:71/177 - (40%) Gaps:22/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 IPNQSKA-----LLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFY 141
            ||....|     |.:...|..::|    |||..:..||.:....|.:..   .|..|.:|.:.|.
Human   209 IPGDKGAKGESGLPDVASLRQQVE----ALQGQVQHLQAAFSQYKKVEL---FPNGQSVGEKIFK 266

  Fly   142 IERHVRQNWFDAADKCRRMGGHLATPQDEDE----LYLIRKQLEARWFWLDISNLVDKDQYISLA 202
            ....|:. :.:|...|.:.||.||:|:...|    ..|:..:.||.:..:..|....|..|   .
Human   267 TAGFVKP-FTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTY---P 327

  Fly   203 TGKEVSYLKWRHGEPK-KSSTANCAYLYA-GDYYTYQCSDRNFFICQ 247
            ||:.:.|..|..|||. ...:.:|..::. |.:....|.::...:|:
Human   328 TGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 26/115 (23%)
SFTPDNP_003010.4 Collagen 46..98 CDD:189968
Collagen 130..201 CDD:189968
Surfac_D-trimer 224..269 CDD:286141 12/51 (24%)
CLECT_collectin_like 262..375 CDD:153061 27/117 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.