DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec10a

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:280 Identity:53/280 - (18%)
Similarity:92/280 - (32%) Gaps:68/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYLIVLLDPQGAQENNC-----------------PKVSLSERLEKRGEFSLVEFDPLLKFIVKNP 56
            |.|:|::...|:|.:..                 .|..| :.|..||: ||......||..| :.
  Rat    48 LLLLVVISVIGSQNSQLRRDLETLRTTLDNTTSNTKAEL-QALASRGD-SLQTGINSLKVEV-DD 109

  Fly    57 HKELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQ--KAINSLQC---S 116
            |.:.|....||    ..|:..::|.:..:.:.|...|.     |..|...|  |.:.:|.|   |
  Rat   110 HGQELQAGRGL----SQKVASLESTVEKKEQTLRTDLS-----EITDRVQQLGKDLKTLTCQLAS 165

  Fly   117 LKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQL- 180
            |||........|....:..||.|::.:.  .:.|.:|...|:....:|.......|...::..: 
  Rat   166 LKNNGSAVACCPLHWMEHEGSCYWFSQS--GKPWPEADKYCQLENSNLVAVNSLAEQNFLQTHMG 228

  Fly   181 -----------EARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKK------SSTANCAYL 228
                       ...|.|:|             .|..|..:..|...:|..      ....:||:.
  Rat   229 SVVTWIGLTDQNGPWRWVD-------------GTDYEKGFTHWAPKQPDNWYGHGLGGGEDCAHF 280

  Fly   229 YAGDYYTYQCSDRNF-FICQ 247
            .:...:......|.: ::|:
  Rat   281 TSDGRWNDDVCQRPYRWVCE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 17/128 (13%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887 29/129 (22%)
Apolipoprotein <63..166 CDD:279749 24/114 (21%)
CLECT_DC-SIGN_like 176..301 CDD:153060 20/140 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.