DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CLEC11A

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_002966.1 Gene:CLEC11A / 6320 HGNCID:10576 Length:323 Species:Homo sapiens


Alignment Length:311 Identity:58/311 - (18%)
Similarity:106/311 - (34%) Gaps:107/311 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GAQENNCPKVSLS-ERLEK-------RGEFSLVEFDPLLKFIVKNPHKELLGEIEGLVG------ 69
            ||||....:.:|. :.|::       ||:              :||    .|.:||...      
Human    35 GAQEEEREREALMLKHLQEALGLPAGRGD--------------ENP----AGTVEGKEDWEMEED 81

  Fly    70 ---HTENKLQPMKSVIPNQS---KALLNYL------------DLHSKLEYLDAALQKAINSLQCS 116
               ..|.:..|..|..|:.|   :.::.|:            .||.:|..||..:.:....|: .
Human    82 QGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLR-Q 145

  Fly   117 LKN--------TKVMSTGKPHPEFQ-----------KLGSRYFYIERHVRQNWFD----AADKCR 158
            |:|        .:.:...:...|.:           :||.:.|.:.|.     |:    |..:|.
Human   146 LRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRD-----FEAQAAAQARCT 205

  Fly   159 RMGGHLATPQDEDELYLIRKQLEA-----RW-FWLDISNLVDKDQYISLATGKEVSYLKWRHG-- 215
            ..||.||.|.|..::..:.:.|.|     .| .||.:.:...:..|: ...|:.||:..|...  
Human   206 ARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYL-FENGQRVSFFAWHRSPR 269

  Fly   216 -----------------EPKKSSTANCAYLYA--GDYYTYQCSDRNFFICQ 247
                             :|...:..||....:  |.::.:.|..|.:::|:
Human   270 PELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/140 (19%)
CLEC11ANP_002966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..106 12/68 (18%)
Cell attachment site. /evidence=ECO:0000255 61..63 1/1 (100%)
CLECT_tetranectin_like 177..321 CDD:153066 30/150 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..295 1/22 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.