DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and clec3ba

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_021322479.1 Gene:clec3ba / 572488 ZFINID:ZDB-GENE-110411-71 Length:197 Species:Danio rerio


Alignment Length:126 Identity:32/126 - (25%)
Similarity:60/126 - (47%) Gaps:15/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KLGSRYFYIERHVRQNWFDAADKCRRMGGHLATP---QDEDEL--YLIRKQLEARWFWLDISNLV 193
            |:..:.|.::. |::::..|.|.|...||.|:||   .:.|:|  |:.:........||.:::::
Zfish    71 KIPGKCFLVDT-VKKDFHSANDDCIAKGGILSTPMSGHENDQLQEYVQQTVGPETHIWLGVNDMI 134

  Fly   194 DKDQYISLATGKEVSYLKWR----HGEPKKSSTANCAYLYA---GDYYTYQCSDRNFFICQ 247
            .:.::|.| ||..:.:..|.    | :|....|.|||.|.:   |.::...|......:||
Zfish   135 KEGEWIDL-TGSPIRFKNWESEITH-QPDGGRTHNCAVLSSTANGKWFDEDCRGEKASVCQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 29/121 (24%)
clec3baXP_021322479.1 CLECT_tetranectin_like 66..194 CDD:153066 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.