DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4n

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_064385.1 Gene:Clec4n / 56620 MGIID:1861231 Length:209 Species:Mus musculus


Alignment Length:96 Identity:24/96 - (25%)
Similarity:36/96 - (37%) Gaps:20/96 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NSLQCSLKNTKVMST--GKPHPEFQKLGSRYFYIERHVRQN-WFDAADKCRRMGGHLATPQDEDE 172
            :||.|..:.|.|...  |.....::..||..:.|.  .::| |..:...|.:||.||.....|.|
Mouse    60 SSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLIS--TKENFWSTSEQNCVQMGAHLVVINTEAE 122

  Fly   173 LYLIRKQL---------------EARWFWLD 188
            ...|.:||               ..:|.|:|
Mouse   123 QNFITQQLNESLSYFLGLSDPQGNGKWQWID 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 17/68 (25%)
Clec4nNP_064385.1 CLECT_DC-SIGN_like 79..204 CDD:153060 18/77 (23%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000250|UniProtKB:Q6EIG7 168..170
Alpha-D-mannopyranose binding. /evidence=ECO:0000250|UniProtKB:Q6EIG7 190..191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.