DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and lectin-24Db

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster


Alignment Length:359 Identity:86/359 - (23%)
Similarity:134/359 - (37%) Gaps:117/359 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYDTYFLYLIV---LLDPQGAQENNCPKVS-LSERLEKRGEFSLVEFDPLLKFIVK------- 54
            ||:.:...:||:|   |::.:.....|...|. |.:...:.|||.|....|||..|||       
  Fly     1 MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQEQWNT 65

  Fly    55 ----------------------------------------------------------------- 54
                                                                             
  Fly    66 SEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELDA 130

  Fly    55 ------NPHKELLGEIEGLVGHT----ENKLQPMKSVIP-----------NQSKALLNYL----- 93
                  |..|.|..::|..:..|    :::|:.:|:.:|           .|.|.|...|     
  Fly   131 RLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPE 195

  Fly    94 DLHSKLEYLDAALQKAINSL-------QCSLKN--TKVMSTGKPHPEFQKLGSRYFYIERHVRQN 149
            |...||:.|:...:..:..|       |.:||.  |||.     .|:|:::|||.|||......:
  Fly   196 DFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVF-----WPKFERIGSRLFYINHKDAYD 255

  Fly   150 WFDAADKCRRMGGHLATPQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRH 214
            |..|.|.||.|||::|..:|::||..|..:|:.:.:||.|::|...:.|:|:|:|:||.:|.|..
  Fly   256 WQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNA 320

  Fly   215 GEPKK-SSTANCAYLYAGDYYTYQCSDRNFFICQ 247
            |||.. :...||..|.........|..:...|||
  Fly   321 GEPNHGNEDENCVELIRSKMNDDPCHRKKHVICQ 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 39/110 (35%)
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 13/111 (12%)
NAT_SF <170..>229 CDD:302625 12/58 (21%)
CLECT 247..354 CDD:153057 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.