DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and lectin-29Ca

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:118/270 - (43%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYDTYFLYLIVLLDPQGAQ---------ENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVKN- 55
            |:||.|....:..|.:..|..         .|..||.                  |:..:.::| 
  Fly     1 MYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKA------------------PMPYYTIENI 47

  Fly    56 -PHKELLGEIEGL--------VGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAIN 111
             .|::.......|        :|:.|.:|:.......||         :.:||..|...::..:.
  Fly    48 DMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQ---------METKLRALKQQIEPYME 103

  Fly   112 SLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLI 176
            :::.|  |...||.      |:|:|||:||:|:..:..|..|.|.||:||||||...||.||..|
  Fly   104 NVKMS--NKIKMSV------FKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEI 160

  Fly   177 RKQLEARWFWLDI-SNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTA--NCAYLYAGDYYTYQC 238
            ..:...:.:|:|| |...|...:||..:|::|.:|||:   |..::..  :|.|:.:.:.|...|
  Fly   161 FSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWK---PNLATNIHNHCVYINSNEMYFENC 222

  Fly   239 SDRNFFICQA 248
            ::.|:|.|||
  Fly   223 ANDNYFACQA 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 40/112 (36%)
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 35/102 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448763
Domainoid 1 1.000 42 1.000 Domainoid score I12232
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
98.900

Return to query results.
Submit another query.