DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and lectin-24A

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:248 Identity:70/248 - (28%)
Similarity:112/248 - (45%) Gaps:49/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYLIVLLDPQGAQENN--CPKVSLSERLEK--RGEFSLVEFDPLLKFIVKNPHKELLGEIEGLVG 69
            :.|.:.||...|..:|  ..::|..|:|::  |.:|::.|                  .:|.:..
  Fly    72 IQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHE------------------SLETINR 118

  Fly    70 HTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQ---KAINSLQCSLKNTKVMSTGKPHPE 131
            :...||...|.    |.:|:.|.:|      |:.|.:.   .|||.:||.            .|.
  Fly   119 YLTVKLDRTKL----QLEAIKNTMD------YMKAQMDGYFSAINGVQCL------------QPG 161

  Fly   132 FQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQL-EARWFWLDISNLVDK 195
            |:|:|.||||||..|..||.||..||||||||||:.:.:.|...|.::| :::.::|.::.....
  Fly   162 FEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKT 226

  Fly   196 DQYISLATGKEVSYLKWRHGEP-KKSSTANCAYLYAGDYYTYQCSDRNFFICQ 247
            ..::|.|:||...|.:|..||| ..:....|..:.....:...|:....||||
  Fly   227 GDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 38/111 (34%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 39/111 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448767
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
109.900

Return to query results.
Submit another query.