DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and lectin-28C

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster


Alignment Length:269 Identity:77/269 - (28%)
Similarity:131/269 - (48%) Gaps:29/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKYDTYFLYLIVLL----DPQGAQENNCPKVSLSERLEKRGEFSLVEFDPLLKFIVKNPHKE-- 59
            ||:......|.|:.:    .|.|.:|.:.....|.:...:.|.|.|....||:..|.:  |:|  
  Fly     1 MFQLKVLLYYAIIAIVINASPSGCEETDRVVCQLEDPRNQCGPFCLEALMPLIGHIAQ--HQEQW 63

  Fly    60 ---LLGEIEGLVGHTENKLQPMKSVIPNQSKALL--------NYLDLHSKLEYLDAALQKAINSL 113
               .|.||:......|.:::..|:.:....|.::        |..:|  |:|...:.||:|:.|:
  Fly    64 KTCKLQEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSEL--KMEGQLSDLQEALTSI 126

  Fly   114 QCSLKN--TKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLI 176
            ..||||  .|:....:    |:::||||.:||..|:|||..|...|::|||:||:..:|.:...|
  Fly   127 TTSLKNMSAKINILHR----FKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAI 187

  Fly   177 RKQL-EARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEP-KKSSTANCAYLYAGDYYTYQCS 239
            ..|| :...:.:.||:|.:|..:||:::||...:|||..||| .:.....|..::.|..:...|:
  Fly   188 VSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSIHNGGMWVASCT 252

  Fly   240 DRNFFICQA 248
            ....:||:|
  Fly   253 SDFKYICEA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 38/111 (34%)
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 31/125 (25%)
CLECT 160..260 CDD:153057 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.