DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CLEC4A

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:147 Identity:30/147 - (20%)
Similarity:49/147 - (33%) Gaps:31/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKP--HPEFQKLGSRYFYIERHVRQNW 150
            |.:.:...:|:|.......:....:|:|..||..|..|...  ...::...|..::|... ..:|
Human    64 AFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTE-SASW 127

  Fly   151 FDAADKCRRMGGHLATPQDEDELYLIRKQL---------------EARWFWLDISNLVDKDQYIS 200
            .|:...|.||..||.....::|...|.:.|               :..|.|      ||:..|..
Human   128 QDSEKDCARMEAHLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQW------VDQTPYNE 186

  Fly   201 LATGKEVSYLKWRHGEP 217
            .:|       .|...||
Human   187 SST-------FWHPREP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 21/96 (22%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 21/105 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.