DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CLEC4A

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:147 Identity:30/147 - (20%)
Similarity:49/147 - (33%) Gaps:31/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 ALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKP--HPEFQKLGSRYFYIERHVRQNW 150
            |.:.:...:|:|.......:....:|:|..||..|..|...  ...::...|..::|... ..:|
Human    64 AFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEETAWSCCPKNWKSFSSNCYFISTE-SASW 127

  Fly   151 FDAADKCRRMGGHLATPQDEDELYLIRKQL---------------EARWFWLDISNLVDKDQYIS 200
            .|:...|.||..||.....::|...|.:.|               :..|.|      ||:..|..
Human   128 QDSEKDCARMEAHLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQW------VDQTPYNE 186

  Fly   201 LATGKEVSYLKWRHGEP 217
            .:|       .|...||
Human   187 SST-------FWHPREP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 21/96 (22%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 21/105 (20%)
Mannose binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 195..197 2/2 (100%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 207..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.