DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CD207

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:219 Identity:46/219 - (21%)
Similarity:85/219 - (38%) Gaps:53/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VGHTENKLQPMKSVIPNQSKALLNYL--------DLHSKLEYLDAALQKA------INSLQCSLK 118
            :|:..::...:|:.: .::.|.:..|        .|::::..|.:.|:||      |.:||.||:
Human   116 LGYVRSQFLKLKTSV-EKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLE 179

  Fly   119 N-TKVMSTGKPHPEFQKLGSRY----FYIERHVRQNWFDAADKCRRMGGHLATPQDEDE---LY- 174
            | :|::.......:....|.:|    ||....:.:.|:.|...|.....||.:...|.|   || 
Human   180 NMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYK 244

  Fly   175 ----------LIRKQLEARWFWLDIS--NLVDKDQYISLATGKEVSYLKWRHGEPKKS-STANCA 226
                      |.:..:|..|.|:|.:  |.|...::             |..|||..: :..:|.
Human   245 TAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRF-------------WIPGEPNNAGNNEHCG 296

  Fly   227 YLYAGDYYTYQ---CSDRNFFICQ 247
            .:.|.....:.   |.....|||:
Human   297 NIKAPSLQAWNDAPCDKTFLFICK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/133 (21%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 30/138 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.