DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Cd209e

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_006248837.1 Gene:Cd209e / 501797 RGDID:1563333 Length:215 Species:Rattus norvegicus


Alignment Length:127 Identity:30/127 - (23%)
Similarity:52/127 - (40%) Gaps:29/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 GSRYFYIERHVRQNWFDAADKCRRMGGHLAT---PQDEDELYLIRKQ------------LEARWF 185
            |:.||:.:.  :::|.::...|:.|...|.|   |:::..|....|:            .|..|:
  Rat    94 GNCYFFSKS--QRDWHNSITACQEMEAQLVTIKSPEEQSFLQQTSKKNGYTWMGLSDLNKEGEWY 156

  Fly   186 WLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQCSDRNFFICQ 247
            |||.|.|.|     ||.     :|  |..|:|......:|.......:...:|.:..|:||:
  Rat   157 WLDGSPLSD-----SLR-----NY--WNEGQPNNIDGQDCVEFRNDGWNDAKCDNWKFWICK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/124 (23%)
Cd209eXP_006248837.1 CLECT_DC-SIGN_like 85..207 CDD:153060 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.