DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and colec10

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 / 496663 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis


Alignment Length:208 Identity:51/208 - (24%)
Similarity:89/208 - (42%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 HKELLGEIE--GLVGHTENKLQPMKSV----------IPNQSKALLNYLDLHSKLEYLDAALQKA 109
            :|.::|:..  ||:|    |:.|:.|.          :|.......:|.|. .:...:...|...
 Frog    73 NKGIIGDSGDLGLIG----KIGPIGSKGDKGHKGLPGLPGGKGKSGSYCDC-GRYRKVVGQLDVN 132

  Fly   110 INSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELY 174
            :..|:.|||..|.:..|     .::...:|:||.|..| |:.||..:||..||.||.|:|:....
 Frog   133 VAHLKSSLKFVKNVIAG-----IRETDEKYYYIVREER-NYRDALTQCRIRGGTLAMPKDQATNS 191

  Fly   175 LIRKQLEARWF---WLDISNLVDKDQYISLATGKEVSYLKWRHGEPKK-SSTANCA-YLYAGDYY 234
            ||...:.....   ::.|:::..:.|::........:|..|:.|||.. |...:|. .|..|.:.
 Frog   192 LIADYISKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGSGYEDCVEMLSTGHWN 256

  Fly   235 TYQCSDRNFFICQ 247
            ...||...:|:|:
 Frog   257 DVDCSLTIYFVCE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 32/114 (28%)
colec10NP_001011227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..76 1/2 (50%)
CLECT_collectin_like 155..270 CDD:153061 33/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm72280
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.