DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and colec11

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001007332.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:271 Species:Danio rerio


Alignment Length:199 Identity:35/199 - (17%)
Similarity:76/199 - (38%) Gaps:57/199 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PHKELLGEIEGLVGHTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNT 120
            |.::::||::..|....|:|:.:|:.:                     |.:::..:.:...:|..
Zfish   117 PLRKMIGEMDIQVVQLTNELKFIKNAV---------------------AGIKETDSKVYLLVKEE 160

  Fly   121 KVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDEL-----YLIRKQL 180
            |                ||           .:|...|:..|||||.|:|....     |:....|
Zfish   161 K----------------RY-----------REAEVFCQGRGGHLAMPKDAAANRAIAGYVTDAGL 198

  Fly   181 EARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKS-STANCAYLY-AGDYYTYQCSDRNF 243
            ..  .::.|::|..:..::.:......::.:||.|||..: ...:|..:. :|::....|....:
Zfish   199 SR--VYIGINDLEREGHFVYVERSPMTTFSRWREGEPNNAYDDEDCVEMVSSGEWIDVACQLTMY 261

  Fly   244 FICQ 247
            |:|:
Zfish   262 FVCE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 24/116 (21%)
colec11NP_001007332.1 gly_rich_SclB <40..>110 CDD:468478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..112
CLECT_collectin_like 151..266 CDD:153061 27/144 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.