DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4a

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001005899.2 Gene:Clec4a / 474143 RGDID:1359662 Length:240 Species:Rattus norvegicus


Alignment Length:257 Identity:53/257 - (20%)
Similarity:84/257 - (32%) Gaps:86/257 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PKVSLSERLEKRGEFSLVEFDPLL------------KFIVK-NPHKELLGEIEGLVGHTENKLQP 77
            |:...:..|.|.|.. ||.|..|:            .||:. ..:.:.|.|.:.:.|.|..:|..
  Rat    29 PREKPTRHLSKPGSL-LVPFTSLMVLLLLLAITFLVAFIIYFQKYSQFLEEKKAIKGITHKELNC 92

  Fly    78 MKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYI 142
            :|:|:..:.|                        |..|..||.|            ..||..:::
  Rat    93 IKNVLLMEEK------------------------SWSCCPKNWK------------PFGSHCYWV 121

  Fly   143 ERHV----RQNWFDAADKCRRMGGHLATPQDEDELYLIRKQL--------------EARWFWLDI 189
            .:|.    :.:|.::...|..||.||.....::|...|...|              ..:|.|   
  Rat   122 TKHTSTYSKASWNESEKNCFSMGAHLLVIHSKEEQDFITGILNRDAAYFIGLWDSGHRQWQW--- 183

  Fly   190 SNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCA---YLYAG-DYYTYQCSDRNFFICQ 247
               |.:..|.:.||       .|..||| .|....|.   :|.:| .:....||.:...:||
  Rat   184 ---VSQTPYNASAT-------FWHKGEP-SSDDEKCVIINHLNSGWGWNDIPCSGKQQSVCQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 27/131 (21%)
Clec4aNP_001005899.2 ITIM motif 5..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..38 1/8 (13%)
CLECT_DC-SIGN_like 107..235 CDD:153060 33/154 (21%)
Mannose binding. /evidence=ECO:0000250|UniProtKB:Q9UMR7 200..202 2/2 (100%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000250|UniProtKB:Q9UMR7 211..213 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.