DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and MBL2

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:149 Identity:36/149 - (24%)
Similarity:68/149 - (45%) Gaps:13/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LDAALQKAINSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADK-CRRMGGHLA 165
            |.|:.:||:.:....:|.....|.||      ::|:::|.....:..  |:.... |.:....:|
Human   107 LAASERKALQTEMARIKKWLTFSLGK------QVGNKFFLTNGEIMT--FEKVKALCVKFQASVA 163

  Fly   166 TPQDEDELYLIRKQLEARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKS-STANCAYLY 229
            ||::..|...|:..::...| |.|::...:.|::.| ||..::|..|..|||..: |..:|..|.
Human   164 TPRNAAENGAIQNLIKEEAF-LGITDEKTEGQFVDL-TGNRLTYTNWNEGEPNNAGSDEDCVLLL 226

  Fly   230 A-GDYYTYQCSDRNFFICQ 247
            . |.:....||..:..:|:
Human   227 KNGQWNDVPCSTSHLAVCE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 26/112 (23%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113 2/5 (40%)
CLECT_collectin_like 136..246 CDD:153061 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.