DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CLEC2A

DIOPT Version :10

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001124183.1 Gene:CLEC2A / 387836 HGNCID:24191 Length:174 Species:Homo sapiens


Alignment Length:126 Identity:23/126 - (18%)
Similarity:42/126 - (33%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LGSR--YFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEARWFWLDISNLVDKDQ 197
            ||.|  .||.....| ||..:...|......||....::::..:::.......|:.:|.      
Human    63 LGVRDKCFYFSDDTR-NWTASKIFCSLQKAELAQIDTQEDMEFLKRYAGTDMHWIGLSR------ 120

  Fly   198 YISLATGKEVSYLKWRHGEPKKS-----STANCAYLYAGDYYT--------YQCSDRNFFI 245
                   |:....||.:|.....     ...:.|:|.|...::        :.||...:|:
Human   121 -------KQGDSWKWTNGTTFNGWFEIIGNGSFAFLSADGVHSSRGFIDIKWICSKPKYFL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 21/124 (17%)
CLEC2ANP_001124183.1 predicted transmembrane domain 28..50
predicted extracellular domain 51..174 22/124 (18%)
CLECT_NK_receptors_like 58..169 CDD:153063 21/119 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.