DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and CG14499

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001261072.3 Gene:CG14499 / 37086 FlyBaseID:FBgn0034317 Length:188 Species:Drosophila melanogaster


Alignment Length:126 Identity:27/126 - (21%)
Similarity:48/126 - (38%) Gaps:30/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 YIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQL-----EARWFWLDISNLVDKDQYIS 200
            :::||           |:.:...|.:..::.|...|.:.|     ::...|...:.|...:.|..
  Fly    52 FLDRH-----------CQSLNAGLLSFSNKMEFTAINEWLTTVVPQSPELWTSGNKLGGSEDYYW 105

  Fly   201 LATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYTYQ-------------CSDRNFFICQA 248
            .:|||:..||.|:.|:| ...|.:|..|.|....|.:             |:.....:|||
  Fly   106 QSTGKKAFYLPWQAGQP-TPITGDCLTLLANVTMTAEGTTMSEHRLSVRGCTKWAPHVCQA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 24/123 (20%)
CG14499NP_001261072.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.