DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4d

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001003707.1 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:176 Identity:40/176 - (22%)
Similarity:61/176 - (34%) Gaps:51/176 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPH---PEFQKLGSRYFYIERHVRQNWF 151
            |.:.|.|::              |.|.|:..:..:||...   |...:......|...:..|.|.
  Rat    54 LKFSDYHTR--------------LTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWH 104

  Fly   152 DAADKCRRMGGHLATPQDEDE---------------LYLIRKQLEARWFWLDISNLVDKDQYISL 201
            ::...|..|..||.|...|.|               |.|..:::|.:|.|      |||..:   
  Rat   105 ESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQW------VDKTPF--- 160

  Fly   202 ATGKEVSYLKWRHGEPKKSSTANCAYL-YAGDYYTYQCSDRNFFIC 246
                ..:.:.|:.||||.|...:|..| |..|.:.:     |.|.|
  Rat   161 ----NPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVW-----NDFPC 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 31/126 (25%)
Clec4dNP_001003707.1 CLECT_DC-SIGN_like 82..206 CDD:153060 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.