DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Cb and Clec4a1

DIOPT Version :9

Sequence 1:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001005890.1 Gene:Clec4a1 / 362430 RGDID:1359109 Length:243 Species:Rattus norvegicus


Alignment Length:209 Identity:42/209 - (20%)
Similarity:62/209 - (29%) Gaps:73/209 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 HTENKLQPMKSVIPNQSKALLNYLDLHSKLEYLDAALQKAINSLQCSLKNTKVMSTGKPHPEFQK 134
            |..:.|...|:.:...:.|.|:.:..||.:|      .|.   ..|..||.|            .
  Rat    75 HMYSDLLEEKNTLQQLNHAKLHCIKNHSSVE------DKV---WSCCPKNWK------------P 118

  Fly   135 LGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEAR---------------W 184
            .||..::..|. ..:|.|:.:||...|.||.....::|...|...|..|               |
  Rat   119 FGSHCYFTSRD-SASWSDSEEKCSHRGAHLLVIHSQEEQDFITDTLNPRAHYYVGLSDTEGHGKW 182

  Fly   185 FWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKS------------------STANCAYLYAG 231
            .|      ||:..:...||       .|...||..:                  |.|.|     .
  Rat   183 QW------VDQTPFNQNAT-------SWHADEPSGNKGFCVVLSYHPNLKGWGWSVAPC-----D 229

  Fly   232 DYYTYQCSDRNFFI 245
            .|:...|..|..::
  Rat   230 GYHRLVCKMRQLYV 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 28/142 (20%)
Clec4a1NP_001005890.1 CLECT_DC-SIGN_like 112..238 CDD:153060 31/156 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.